PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0052500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 145aa    MW: 16008.7 Da    PI: 10.8634
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0052500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.95.4e-25148552
          RWP-RK  5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                    ++le++s+yF+ pi+ AAkeL+++lT LK++CR++GI+RWPhRk+ksl
  Spipo0G0052500  1 MTLEEVSRYFYVPITVAAKELKMGLTQLKKKCRELGIPRWPHRKMKSL 48
                    689*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166168IPR003035RWP-RK domain
PfamPF020424.5E-21148IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MTLEEVSRYF YVPITVAAKE LKMGLTQLKK KCRELGIPRW PHRKMKSLQA LISNVQELGR  60
EDGEMGEMQL QRAIEILEGE RAAMERVPGT QLEERTKRLR QACFKANFKK RRQSKGGVAA  120
AAAAAAAGRR NPVKASCPSA TGVP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006855335.26e-54PREDICTED: protein RKD1
SwissprotQ9M9U91e-43RKD1_ARATH; Protein RKD1
TrEMBLW1Q0Q99e-52W1Q0Q9_AMBTC; Uncharacterized protein
STRINGGLYMA05G01030.21e-44(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-44RWP-RK domain-containing protein